TGIF2 polyclonal antibody (A01)
  • TGIF2 polyclonal antibody (A01)

TGIF2 polyclonal antibody (A01)

Ref: AB-H00060436-A01
TGIF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TGIF2.
Información adicional
Size 50 uL
Gene Name TGIF2
Gene Alias -
Gene Description TGFB-induced factor homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60436

Enviar un mensaje


TGIF2 polyclonal antibody (A01)

TGIF2 polyclonal antibody (A01)