LGR6 polyclonal antibody (A01)
  • LGR6 polyclonal antibody (A01)

LGR6 polyclonal antibody (A01)

Ref: AB-H00059352-A01
LGR6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LGR6.
Información adicional
Size 50 uL
Gene Name LGR6
Gene Alias FLJ14471|GPCR|VTS20631
Gene Description leucine-rich repeat-containing G protein-coupled receptor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LGR6 (NP_067649, 403 a.a. ~ 496 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 59352

Enviar un mensaje


LGR6 polyclonal antibody (A01)

LGR6 polyclonal antibody (A01)