ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00059348-D01P
ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF350 protein.
Información adicional
Size 100 ug
Gene Name ZNF350
Gene Alias ZBRK1|ZFQR
Gene Description zinc finger protein 350
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF350 (NP_067645.3, 1 a.a. ~ 532 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 59348

Enviar un mensaje


ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF350 purified MaxPab rabbit polyclonal antibody (D01P)