CACNG7 monoclonal antibody (M01), clone 1F7
  • CACNG7 monoclonal antibody (M01), clone 1F7

CACNG7 monoclonal antibody (M01), clone 1F7

Ref: AB-H00059284-M01
CACNG7 monoclonal antibody (M01), clone 1F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CACNG7.
Información adicional
Size 100 ug
Gene Name CACNG7
Gene Alias -
Gene Description calcium channel, voltage-dependent, gamma subunit 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CACNG7 (NP_114102.2, 203 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 59284
Clone Number 1F7
Iso type IgG1 Kappa

Enviar un mensaje


CACNG7 monoclonal antibody (M01), clone 1F7

CACNG7 monoclonal antibody (M01), clone 1F7