IL21 polyclonal antibody (A01)
  • IL21 polyclonal antibody (A01)

IL21 polyclonal antibody (A01)

Ref: AB-H00059067-A01
IL21 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL21.
Información adicional
Size 50 uL
Gene Name IL21
Gene Alias IL-21|Za11
Gene Description interleukin 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL21 (NM_021803, 63 a.a. ~ 162 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 59067

Enviar un mensaje


IL21 polyclonal antibody (A01)

IL21 polyclonal antibody (A01)