IL22RA1 monoclonal antibody (M03), clone 6B5
  • IL22RA1 monoclonal antibody (M03), clone 6B5

IL22RA1 monoclonal antibody (M03), clone 6B5

Ref: AB-H00058985-M03
IL22RA1 monoclonal antibody (M03), clone 6B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant IL22RA1.
Información adicional
Size 100 ug
Gene Name IL22RA1
Gene Alias CRF2-9|IL22R|IL22R1
Gene Description interleukin 22 receptor, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq EDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL22RA1 (AAH29273, 19 a.a. ~ 574 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58985
Clone Number 6B5
Iso type IgG3 Kappa

Enviar un mensaje


IL22RA1 monoclonal antibody (M03), clone 6B5

IL22RA1 monoclonal antibody (M03), clone 6B5