IL22RA1 monoclonal antibody (M01), clone 2E6
  • IL22RA1 monoclonal antibody (M01), clone 2E6

IL22RA1 monoclonal antibody (M01), clone 2E6

Ref: AB-H00058985-M01
IL22RA1 monoclonal antibody (M01), clone 2E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL22RA1.
Información adicional
Size 100 ug
Gene Name IL22RA1
Gene Alias CRF2-9|IL22R|IL22R1
Gene Description interleukin 22 receptor, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,ELISA
Immunogen Prot. Seq MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL22RA1 (NP_067081, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58985
Clone Number 2E6
Iso type IgG2a Kappa

Enviar un mensaje


IL22RA1 monoclonal antibody (M01), clone 2E6

IL22RA1 monoclonal antibody (M01), clone 2E6