IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)
  • IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)

IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00058985-B01P
IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL22RA1 protein.
Información adicional
Size 50 ug
Gene Name IL22RA1
Gene Alias CRF2-9|IL22R|IL22R1
Gene Description interleukin 22 receptor, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL22RA1 (NP_067081.2, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58985

Enviar un mensaje


IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)

IL22RA1 purified MaxPab mouse polyclonal antibody (B01P)