MYOZ1 monoclonal antibody (M05), clone 1E8
  • MYOZ1 monoclonal antibody (M05), clone 1E8

MYOZ1 monoclonal antibody (M05), clone 1E8

Ref: AB-H00058529-M05
MYOZ1 monoclonal antibody (M05), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MYOZ1.
Información adicional
Size 100 ug
Gene Name MYOZ1
Gene Alias CS-2|FATZ|MYOZ
Gene Description myozenin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYOZ1 (NP_067068.1, 200 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58529
Clone Number 1E8
Iso type IgG2a Kappa

Enviar un mensaje


MYOZ1 monoclonal antibody (M05), clone 1E8

MYOZ1 monoclonal antibody (M05), clone 1E8