MID1IP1 monoclonal antibody (M01), clone 8G8
  • MID1IP1 monoclonal antibody (M01), clone 8G8

MID1IP1 monoclonal antibody (M01), clone 8G8

Ref: AB-H00058526-M01
MID1IP1 monoclonal antibody (M01), clone 8G8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MID1IP1.
Información adicional
Size 100 ug
Gene Name MID1IP1
Gene Alias FLJ10386|G12-like|MIG12|STRAIT11499|THRSPL
Gene Description MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MID1IP1 (NP_067065.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58526
Clone Number 8G8
Iso type IgG1 Kappa

Enviar un mensaje


MID1IP1 monoclonal antibody (M01), clone 8G8

MID1IP1 monoclonal antibody (M01), clone 8G8