MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)
  • MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00058526-B01P
MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MID1IP1 protein.
Información adicional
Size 50 ug
Gene Name MID1IP1
Gene Alias FLJ10386|G12-like|MIG12|STRAIT11499|THRSPL
Gene Description MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MID1IP1 (NP_067065, 1 a.a. ~ 183 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58526

Enviar un mensaje


MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)

MID1IP1 purified MaxPab mouse polyclonal antibody (B01P)