PROL1 purified MaxPab mouse polyclonal antibody (B01P)
  • PROL1 purified MaxPab mouse polyclonal antibody (B01P)

PROL1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00058503-B01P
PROL1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PROL1 protein.
Información adicional
Size 50 ug
Gene Name PROL1
Gene Alias BPLP|PRL1
Gene Description proline rich, lacrimal 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSPLSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRILKPPFPPIPFFLAIYLPISNPEPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTVPISSTPEPATSISAATPAASTENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PROL1 (AAI48721.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58503

Enviar un mensaje


PROL1 purified MaxPab mouse polyclonal antibody (B01P)

PROL1 purified MaxPab mouse polyclonal antibody (B01P)