PRUNE monoclonal antibody (M01), clone 1C11
  • PRUNE monoclonal antibody (M01), clone 1C11

PRUNE monoclonal antibody (M01), clone 1C11

Ref: AB-H00058497-M01
PRUNE monoclonal antibody (M01), clone 1C11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PRUNE.
Información adicional
Size 100 ug
Gene Name PRUNE
Gene Alias DRES-17|HTCD37
Gene Description prune homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKRSELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHVSVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAISAIYM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRUNE (AAH25304, 1 a.a. ~ 453 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58497
Clone Number 1C11
Iso type IgG2a Kappa

Enviar un mensaje


PRUNE monoclonal antibody (M01), clone 1C11

PRUNE monoclonal antibody (M01), clone 1C11