JAM2 purified MaxPab rabbit polyclonal antibody (D01P)
  • JAM2 purified MaxPab rabbit polyclonal antibody (D01P)

JAM2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00058494-D01P
JAM2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human JAM2 protein.
Información adicional
Size 100 ug
Gene Name JAM2
Gene Alias C21orf43|CD322|JAM-B|JAMB|PRO245|VE-JAM|VEJAM
Gene Description junctional adhesion molecule 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen JAM2 (NP_067042.1, 1 a.a. ~ 298 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58494

Enviar un mensaje


JAM2 purified MaxPab rabbit polyclonal antibody (D01P)

JAM2 purified MaxPab rabbit polyclonal antibody (D01P)