ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00058491-D01P
ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF71 protein.
Información adicional
Size 100 ug
Gene Name ZNF71
Gene Alias EZFIT
Gene Description zinc finger protein 71
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF71 (NP_067039.1, 1 a.a. ~ 489 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58491

Enviar un mensaje


ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)