PCTP monoclonal antibody (M03A), clone 3A11
  • PCTP monoclonal antibody (M03A), clone 3A11

PCTP monoclonal antibody (M03A), clone 3A11

Ref: AB-H00058488-M03A
PCTP monoclonal antibody (M03A), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCTP.
Información adicional
Size 200 uL
Gene Name PCTP
Gene Alias STARD2
Gene Description phosphatidylcholine transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCTP (NP_067036, 106 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 58488
Clone Number 3A11
Iso type IgG2a Kappa

Enviar un mensaje


PCTP monoclonal antibody (M03A), clone 3A11

PCTP monoclonal antibody (M03A), clone 3A11