PCTP purified MaxPab rabbit polyclonal antibody (D01P)
  • PCTP purified MaxPab rabbit polyclonal antibody (D01P)

PCTP purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00058488-D01P
PCTP purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PCTP protein.
Información adicional
Size 100 ug
Gene Name PCTP
Gene Alias STARD2
Gene Description phosphatidylcholine transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCTP (AAH12084.1, 1 a.a. ~ 214 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58488

Enviar un mensaje


PCTP purified MaxPab rabbit polyclonal antibody (D01P)

PCTP purified MaxPab rabbit polyclonal antibody (D01P)