PCTP polyclonal antibody (A01)
  • PCTP polyclonal antibody (A01)

PCTP polyclonal antibody (A01)

Ref: AB-H00058488-A01
PCTP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PCTP.
Información adicional
Size 50 uL
Gene Name PCTP
Gene Alias STARD2
Gene Description phosphatidylcholine transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCTP (AAH12084, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 58488

Enviar un mensaje


PCTP polyclonal antibody (A01)

PCTP polyclonal antibody (A01)