ZBED5 purified MaxPab mouse polyclonal antibody (B01P)
  • ZBED5 purified MaxPab mouse polyclonal antibody (B01P)

ZBED5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00058486-B01P
ZBED5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZBED5 protein.
Información adicional
Size 50 ug
Gene Name ZBED5
Gene Alias FLJ41239
Gene Description zinc finger, BED-type containing 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIAPILCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZBED5 (AAH38508.1, 1 a.a. ~ 693 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58486

Enviar un mensaje


ZBED5 purified MaxPab mouse polyclonal antibody (B01P)

ZBED5 purified MaxPab mouse polyclonal antibody (B01P)