TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)
  • TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)

TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00058485-B01P
TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRAPPC1 protein.
Información adicional
Size 50 ug
Gene Name TRAPPC1
Gene Alias BET5|MUM2
Gene Description trafficking protein particle complex 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRAPPC1 (NP_067033.1, 1 a.a. ~ 145 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58485

Enviar un mensaje


TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)

TRAPPC1 purified MaxPab mouse polyclonal antibody (B01P)