ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00058478-D01P
ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ENOPH1 protein.
Información adicional
Size 100 ug
Gene Name ENOPH1
Gene Alias DKFZp586M0524|E1|FLJ12594|MASA|MST145
Gene Description enolase-phosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ENOPH1 (NP_067027.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 58478

Enviar un mensaje


ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)