GRHL3 monoclonal antibody (M01), clone 3C5
  • GRHL3 monoclonal antibody (M01), clone 3C5

GRHL3 monoclonal antibody (M01), clone 3C5

Ref: AB-H00057822-M01
GRHL3 monoclonal antibody (M01), clone 3C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRHL3.
Información adicional
Size 100 ug
Gene Name GRHL3
Gene Alias MGC46624|SOM|TFCP2L4
Gene Description grainyhead-like 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRHL3 (NP_067003, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57822
Clone Number 3C5
Iso type IgG2a Kappa

Enviar un mensaje


GRHL3 monoclonal antibody (M01), clone 3C5

GRHL3 monoclonal antibody (M01), clone 3C5