CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)

CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057820-D01P
CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCNB1IP1 protein.
Información adicional
Size 100 ug
Gene Name CCNB1IP1
Gene Alias C14orf18|HEI10
Gene Description cyclin B1 interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNB1IP1 (NP_878269.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57820

Enviar un mensaje


CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)

CCNB1IP1 purified MaxPab rabbit polyclonal antibody (D01P)