LSM2 polyclonal antibody (A01)
  • LSM2 polyclonal antibody (A01)

LSM2 polyclonal antibody (A01)

Ref: AB-H00057819-A01
LSM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LSM2.
Información adicional
Size 50 uL
Gene Name LSM2
Gene Alias C6orf28|G7b|YBL026W|snRNP
Gene Description LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LSM2 (NP_067000, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57819

Enviar un mensaje


LSM2 polyclonal antibody (A01)

LSM2 polyclonal antibody (A01)