RAB40C polyclonal antibody (A01)
  • RAB40C polyclonal antibody (A01)

RAB40C polyclonal antibody (A01)

Ref: AB-H00057799-A01
RAB40C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAB40C.
Información adicional
Size 50 uL
Gene Name RAB40C
Gene Alias RARL|RASL8C
Gene Description RAB40C, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB40C (NP_066991, 150 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57799

Enviar un mensaje


RAB40C polyclonal antibody (A01)

RAB40C polyclonal antibody (A01)