ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)

ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057763-D01P
ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ANKRA2 protein.
Información adicional
Size 100 ug
Gene Name ANKRA2
Gene Alias ANKRA
Gene Description ankyrin repeat, family A (RFXANK-like), 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIKQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANKRA2 (NP_075526.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57763

Enviar un mensaje


ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)

ANKRA2 purified MaxPab rabbit polyclonal antibody (D01P)