IGDCC4 monoclonal antibody (M05), clone 6A3
  • IGDCC4 monoclonal antibody (M05), clone 6A3

IGDCC4 monoclonal antibody (M05), clone 6A3

Ref: AB-H00057722-M05
IGDCC4 monoclonal antibody (M05), clone 6A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IGDCC4.
Información adicional
Size 100 ug
Gene Name IGDCC4
Gene Alias DDM36|FLJ42051|KIAA1628|NOPE
Gene Description immunoglobulin superfamily, DCC subclass, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq DLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGDCC4 (NP_066013, 1152 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57722
Clone Number 6A3
Iso type IgG2a Kappa

Enviar un mensaje


IGDCC4 monoclonal antibody (M05), clone 6A3

IGDCC4 monoclonal antibody (M05), clone 6A3