SEMA4G polyclonal antibody (A01)
  • SEMA4G polyclonal antibody (A01)

SEMA4G polyclonal antibody (A01)

Ref: AB-H00057715-A01
SEMA4G polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA4G.
Información adicional
Size 50 uL
Gene Name SEMA4G
Gene Alias FLJ20590|KIAA1619|MGC102867
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCHQKGKNNQTEC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA4G (NP_060363, 24 a.a. ~ 115 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57715

Enviar un mensaje


SEMA4G polyclonal antibody (A01)

SEMA4G polyclonal antibody (A01)