CPNE5 monoclonal antibody (M02), clone 2G4
  • CPNE5 monoclonal antibody (M02), clone 2G4

CPNE5 monoclonal antibody (M02), clone 2G4

Ref: AB-H00057699-M02
CPNE5 monoclonal antibody (M02), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPNE5.
Información adicional
Size 50 ug
Gene Name CPNE5
Gene Alias COPN5|CPN5|DKFZp666C234|KIAA1599
Gene Description copine V
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPNE5 (NP_065990, 393 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57699
Clone Number 2G4
Iso type IgG1 Kappa

Enviar un mensaje


CPNE5 monoclonal antibody (M02), clone 2G4

CPNE5 monoclonal antibody (M02), clone 2G4