C17orf27 monoclonal antibody (M01), clone 5C12
  • C17orf27 monoclonal antibody (M01), clone 5C12

C17orf27 monoclonal antibody (M01), clone 5C12

Ref: AB-H00057674-M01
C17orf27 monoclonal antibody (M01), clone 5C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C17orf27.
Información adicional
Size 100 ug
Gene Name RNF213
Gene Alias C17orf27|KIAA1554
Gene Description ring finger protein 213
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C17orf27 (NP_065965, 2016 a.a. ~ 2112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57674
Clone Number 5C12
Iso type IgG2a Kappa

Enviar un mensaje


C17orf27 monoclonal antibody (M01), clone 5C12

C17orf27 monoclonal antibody (M01), clone 5C12