KIAA1542 polyclonal antibody (A01)
  • KIAA1542 polyclonal antibody (A01)

KIAA1542 polyclonal antibody (A01)

Ref: AB-H00057661-A01
KIAA1542 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KIAA1542.
Información adicional
Size 50 uL
Gene Name PHRF1
Gene Alias KIAA1542|RNF221
Gene Description PHD and ring finger domains 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLEAAGSFNSDDDAESCPICLNAFRDQAVGTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILKKIPVENTKASEEEEDPTFCEVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIAA1542 (NP_065952, 92 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57661

Enviar un mensaje


KIAA1542 polyclonal antibody (A01)

KIAA1542 polyclonal antibody (A01)