POGK MaxPab rabbit polyclonal antibody (D01)
  • POGK MaxPab rabbit polyclonal antibody (D01)

POGK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00057645-D01
POGK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human POGK protein.
Información adicional
Size 100 uL
Gene Name POGK
Gene Alias BASS2|KIAA1513|KIAA15131|LST003
Gene Description pogo transposable element with KRAB domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKALYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQFPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVEYAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POGK (NP_060012.3, 1 a.a. ~ 609 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 57645

Enviar un mensaje


POGK MaxPab rabbit polyclonal antibody (D01)

POGK MaxPab rabbit polyclonal antibody (D01)