EP400 monoclonal antibody (M01), clone 2A7
  • EP400 monoclonal antibody (M01), clone 2A7

EP400 monoclonal antibody (M01), clone 2A7

Ref: AB-H00057634-M01
EP400 monoclonal antibody (M01), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EP400.
Información adicional
Size 100 ug
Gene Name EP400
Gene Alias CAGH32|DKFZP434I225|FLJ42018|FLJ45115|P400|TNRC12
Gene Description E1A binding protein p400
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EP400 (NP_056224.2, 743 a.a. ~ 850 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57634
Clone Number 2A7
Iso type IgG2a Kappa

Enviar un mensaje


EP400 monoclonal antibody (M01), clone 2A7

EP400 monoclonal antibody (M01), clone 2A7