SH3RF1 polyclonal antibody (A01)
  • SH3RF1 polyclonal antibody (A01)

SH3RF1 polyclonal antibody (A01)

Ref: AB-H00057630-A01
SH3RF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SH3RF1.
Información adicional
Size 50 uL
Gene Name SH3RF1
Gene Alias FLJ21602|KIAA1494|POSH|RNF142|SH3MD2
Gene Description SH3 domain containing ring finger 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3RF1 (NP_065921, 790 a.a. ~ 888 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57630

Enviar un mensaje


SH3RF1 polyclonal antibody (A01)

SH3RF1 polyclonal antibody (A01)