KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)
  • KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)

KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057613-B01P
KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIAA1467 protein.
Información adicional
Size 50 ug
Gene Name KIAA1467
Gene Alias DKFZp781O012
Gene Description KIAA1467
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEPDSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLLCAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVSRPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATSGKAIWTLNPNYLSNG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIAA1467 (NP_065904.1, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57613

Enviar un mensaje


KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)

KIAA1467 purified MaxPab mouse polyclonal antibody (B01P)