PCDH10 monoclonal antibody (M07), clone 2H6
  • PCDH10 monoclonal antibody (M07), clone 2H6

PCDH10 monoclonal antibody (M07), clone 2H6

Ref: AB-H00057575-M07
PCDH10 monoclonal antibody (M07), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDH10.
Información adicional
Size 100 ug
Gene Name PCDH10
Gene Alias DKFZp761O2023|KIAA1400|MGC133344|OL-PCDH|PCDH19
Gene Description protocadherin 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH10 (NP_065866, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57575
Clone Number 2H6
Iso type IgG2b Kappa

Enviar un mensaje


PCDH10 monoclonal antibody (M07), clone 2H6

PCDH10 monoclonal antibody (M07), clone 2H6