MICAL3 monoclonal antibody (M08), clone 3A6
  • MICAL3 monoclonal antibody (M08), clone 3A6

MICAL3 monoclonal antibody (M08), clone 3A6

Ref: AB-H00057553-M08
MICAL3 monoclonal antibody (M08), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MICAL3.
Información adicional
Size 100 ug
Gene Name MICAL3
Gene Alias KIAA0819|MGC189703
Gene Description microtubule associated monoxygenase, calponin and LIM domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MICAL3 (XP_032996.2, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57553
Clone Number 3A6
Iso type IgG2a Kappa

Enviar un mensaje


MICAL3 monoclonal antibody (M08), clone 3A6

MICAL3 monoclonal antibody (M08), clone 3A6