ALPK3 monoclonal antibody (M01), clone 4G4
  • ALPK3 monoclonal antibody (M01), clone 4G4

ALPK3 monoclonal antibody (M01), clone 4G4

Ref: AB-H00057538-M01
ALPK3 monoclonal antibody (M01), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALPK3.
Información adicional
Size 100 ug
Gene Name ALPK3
Gene Alias FLJ12881|FLJ21176|KIAA1330|MAK|MIDORI
Gene Description alpha-kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq SSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQKKGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALPK3 (NP_065829, 1811 a.a. ~ 1906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57538
Clone Number 4G4
Iso type IgG1 Kappa

Enviar un mensaje


ALPK3 monoclonal antibody (M01), clone 4G4

ALPK3 monoclonal antibody (M01), clone 4G4