SORCS2 monoclonal antibody (M03), clone 1D7
  • SORCS2 monoclonal antibody (M03), clone 1D7

SORCS2 monoclonal antibody (M03), clone 1D7

Ref: AB-H00057537-M03
SORCS2 monoclonal antibody (M03), clone 1D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SORCS2.
Información adicional
Size 100 ug
Gene Name SORCS2
Gene Alias -
Gene Description sortilin-related VPS10 domain containing receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORCS2 (NP_065828.1, 802 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57537
Clone Number 1D7
Iso type IgG2a Kappa

Enviar un mensaje


SORCS2 monoclonal antibody (M03), clone 1D7

SORCS2 monoclonal antibody (M03), clone 1D7