HACE1 monoclonal antibody (M04), clone 2B3
  • HACE1 monoclonal antibody (M04), clone 2B3

HACE1 monoclonal antibody (M04), clone 2B3

Ref: AB-H00057531-M04
HACE1 monoclonal antibody (M04), clone 2B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HACE1.
Información adicional
Size 100 ug
Gene Name HACE1
Gene Alias -
Gene Description HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HACE1 (NP_065822, 800 a.a. ~ 909 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57531
Clone Number 2B3
Iso type IgG2a Kappa

Enviar un mensaje


HACE1 monoclonal antibody (M04), clone 2B3

HACE1 monoclonal antibody (M04), clone 2B3