PCDH19 monoclonal antibody (M04), clone 2G10
  • PCDH19 monoclonal antibody (M04), clone 2G10

PCDH19 monoclonal antibody (M04), clone 2G10

Ref: AB-H00057526-M04
PCDH19 monoclonal antibody (M04), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDH19.
Información adicional
Size 100 ug
Gene Name PCDH19
Gene Alias DKFZp686P1843|EFMR|KIAA1313
Gene Description protocadherin 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQPDLIINGAPLPETENYSFDSNYVNSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDH19 (NP_065817, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57526
Clone Number 2G10
Iso type IgG2a Kappa

Enviar un mensaje


PCDH19 monoclonal antibody (M04), clone 2G10

PCDH19 monoclonal antibody (M04), clone 2G10