SRGAP1 monoclonal antibody (M07), clone 5D10
  • SRGAP1 monoclonal antibody (M07), clone 5D10

SRGAP1 monoclonal antibody (M07), clone 5D10

Ref: AB-H00057522-M07
SRGAP1 monoclonal antibody (M07), clone 5D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SRGAP1.
Información adicional
Size 100 ug
Gene Name SRGAP1
Gene Alias ARHGAP13|FLJ22166|KIAA1304
Gene Description SLIT-ROBO Rho GTPase activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SRGAP1 (NP_065813, 952 a.a. ~ 1050 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57522
Clone Number 5D10
Iso type IgG2a Kappa

Enviar un mensaje


SRGAP1 monoclonal antibody (M07), clone 5D10

SRGAP1 monoclonal antibody (M07), clone 5D10