RPTOR purified MaxPab mouse polyclonal antibody (B01P)
  • RPTOR purified MaxPab mouse polyclonal antibody (B01P)

RPTOR purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057521-B01P
RPTOR purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RPTOR protein.
Información adicional
Size 50 ug
Gene Name RPTOR
Gene Alias KOG1|Mip1
Gene Description regulatory associated protein of MTOR, complex 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPTOR (AAH64515.1, 1 a.a. ~ 379 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57521

Enviar un mensaje


RPTOR purified MaxPab mouse polyclonal antibody (B01P)

RPTOR purified MaxPab mouse polyclonal antibody (B01P)