COG6 monoclonal antibody (M01), clone 5B5
  • COG6 monoclonal antibody (M01), clone 5B5

COG6 monoclonal antibody (M01), clone 5B5

Ref: AB-H00057511-M01
COG6 monoclonal antibody (M01), clone 5B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COG6.
Información adicional
Size 100 ug
Gene Name COG6
Gene Alias COD2|DKFZp313D191|KIAA1134
Gene Description component of oligomeric golgi complex 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG6 (NP_065802, 558 a.a. ~ 657 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57511
Clone Number 5B5
Iso type IgG1 Kappa

Enviar un mensaje


COG6 monoclonal antibody (M01), clone 5B5

COG6 monoclonal antibody (M01), clone 5B5