MTA3 monoclonal antibody (M06), clone 2C5
  • MTA3 monoclonal antibody (M06), clone 2C5

MTA3 monoclonal antibody (M06), clone 2C5

Ref: AB-H00057504-M06
MTA3 monoclonal antibody (M06), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTA3.
Información adicional
Size 100 ug
Gene Name MTA3
Gene Alias KIAA1266
Gene Description metastasis associated 1 family, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTA3 (NP_065795, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57504
Clone Number 2C5
Iso type IgG2b Kappa

Enviar un mensaje


MTA3 monoclonal antibody (M06), clone 2C5

MTA3 monoclonal antibody (M06), clone 2C5