ARID1B monoclonal antibody (M01), clone 2D2
  • ARID1B monoclonal antibody (M01), clone 2D2

ARID1B monoclonal antibody (M01), clone 2D2

Ref: AB-H00057492-M01
ARID1B monoclonal antibody (M01), clone 2D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARID1B.
Información adicional
Size 100 ug
Gene Name ARID1B
Gene Alias 6A3-5|BAF250b|BRIGHT|DAN15|ELD/OSA1|KIAA1235|p250R
Gene Description AT rich interactive domain 1B (SWI1-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57492
Clone Number 2D2
Iso type IgG2b Kappa

Enviar un mensaje


ARID1B monoclonal antibody (M01), clone 2D2

ARID1B monoclonal antibody (M01), clone 2D2