FAM62B purified MaxPab mouse polyclonal antibody (B01P)
  • FAM62B purified MaxPab mouse polyclonal antibody (B01P)

FAM62B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057488-B01P
FAM62B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FAM62B protein.
Información adicional
Size 50 ug
Gene Name FAM62B
Gene Alias CHR2SYT|ESYT2|KIAA1228
Gene Description family with sequence similarity 62 (C2 domain containing) member B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FAM62B (AAH13957.1, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57488

Enviar un mensaje


FAM62B purified MaxPab mouse polyclonal antibody (B01P)

FAM62B purified MaxPab mouse polyclonal antibody (B01P)