RNF150 polyclonal antibody (A01)
  • RNF150 polyclonal antibody (A01)

RNF150 polyclonal antibody (A01)

Ref: AB-H00057484-A01
RNF150 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF150.
Información adicional
Size 50 uL
Gene Name RNF150
Gene Alias MGC125502
Gene Description ring finger protein 150
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNASAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF150 (NP_065775, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57484

Enviar un mensaje


RNF150 polyclonal antibody (A01)

RNF150 polyclonal antibody (A01)