USP31 monoclonal antibody (M01), clone 3B6
  • USP31 monoclonal antibody (M01), clone 3B6

USP31 monoclonal antibody (M01), clone 3B6

Ref: AB-H00057478-M01
USP31 monoclonal antibody (M01), clone 3B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP31.
Información adicional
Size 100 ug
Gene Name USP31
Gene Alias KIAA1203
Gene Description ubiquitin specific peptidase 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP31 (NP_065769, 1254 a.a. ~ 1352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57478
Clone Number 3B6
Iso type IgG2a Kappa

Enviar un mensaje


USP31 monoclonal antibody (M01), clone 3B6

USP31 monoclonal antibody (M01), clone 3B6