CNOT6 monoclonal antibody (M01), clone 4A3
  • CNOT6 monoclonal antibody (M01), clone 4A3

CNOT6 monoclonal antibody (M01), clone 4A3

Ref: AB-H00057472-M01
CNOT6 monoclonal antibody (M01), clone 4A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNOT6.
Información adicional
Size 100 ug
Gene Name CNOT6
Gene Alias CCR4|KIAA1194
Gene Description CCR4-NOT transcription complex, subunit 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT6 (NP_056270.2, 112 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57472
Clone Number 4A3
Iso type IgG2b Kappa

Enviar un mensaje


CNOT6 monoclonal antibody (M01), clone 4A3

CNOT6 monoclonal antibody (M01), clone 4A3